PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F01614.1.p
Common NameEUGRSUZ_F01614
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family SRS
Protein Properties Length: 241aa    MW: 25564.6 Da    PI: 7.7967
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F01614.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7022151.8e-66131693154
            DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa....aeaaskrkrel.....kskkqsal 86 
                        g+++CqdCGnqakkdC+h RCRtCCksrgf+C thvkstWvpaakrrerqq+la+a+  + +++    +   ++++ +l     +++  + +
  Eucgr.F01614.1.p  13 GGGINCQDCGNQAKKDCVHLRCRTCCKSRGFECPTHVKSTWVPAAKRRERQQHLATAAVMHHHQQqqplR---QEQPFQLdhyfkRQRDGEVA 102
                       5789*************************************************99987766555522331...22222223333233333344 PP

            DUF702  87 sstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                       ++   + a+s  e+  + lP+e++s+avfrc+rvs++dd +ee+aYqtav+igGhvf+GiLydqG+e+
  Eucgr.F01614.1.p 103 AAPPFPIATSGLEVG-QALPPEINSSAVFRCLRVSAMDDTDEEFAYQTAVNIGGHVFRGILYDQGPES 169
                       444555665554444.44************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.6E-6415168IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.3E-271759IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016245.4E-25120167IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MMMRHGGEGG GGGGGINCQD CGNQAKKDCV HLRCRTCCKS RGFECPTHVK STWVPAAKRR  60
ERQQHLATAA VMHHHQQQQP LRQEQPFQLD HYFKRQRDGE VAAAPPFPIA TSGLEVGQAL  120
PPEINSSAVF RCLRVSAMDD TDEEFAYQTA VNIGGHVFRG ILYDQGPESR FSSAGESSSG  180
GGGGSHQPLN LITAAPGSTS AAATTAAATG NLATTLLDPS IYATPLNAFM AGTQFFPPPR  240
*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F01614.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010061013.11e-179PREDICTED: protein SHI RELATED SEQUENCE 1-like
SwissprotQ9XGX07e-74SHI_ARATH; Protein SHORT INTERNODES
TrEMBLA0A059BQA61e-180A0A059BQA6_EUCGR; Uncharacterized protein
STRINGVIT_18s0001g13420.t017e-82(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.11e-62Lateral root primordium (LRP) protein-related